DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG16710

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:102/266 - (38%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITMGYPAYEGKVPYIVGLGFSKNGGGTW-------CGGSIIGNTWVMTAKHC--TDGMESVTIY 92
            ||..|......::|::..:.::......|       |.||:|.|.:|:||.||  ..|::...:.
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    93 YGALWRLQAQ--YTHWVGRSD---------------------FIEHGSGDISLIRTPHVDFWSLV 134
            .|....|...  .||..||..                     |.|....||:|:|......::..
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQ 234

  Fly   135 NKVELPRYDDRYNN--YQGWWALVSGWGKTSDEGG----VSEYLNCVDVQIGEN----SVCENYY 189
            .|....:.|..::|  :......::|||.:..:|.    :..|:|      |.|    |:.|...
  Fly   235 IKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVN------GRNADECSLSEPSL 293

  Fly   190 GSFSGDLICIPTPENKGTCSGDSGGPL--VIHDGNRQ----VGIVSFGSSAGCLSNGPKGMVRVT 248
            |......||........||.|||||||  ::..|:.:    .||.|:|.|. | ..||....:.:
  Fly   294 GLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ-C-GYGPAAYTKTS 356

  Fly   249 SYLDWI 254
            .:::||
  Fly   357 KFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 62/264 (23%)
Tryp_SPc 41..257 CDD:238113 62/262 (24%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 62/264 (23%)
Tryp_SPc 106..362 CDD:238113 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.