DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG5255

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:122/284 - (42%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLAVLLLGVIASATAFEK----PVFWKDVPVGKASIEGRITMGYPAYEGKVPY---IVGLGFSKN 60
            :|.:||..|:.:::|..:    |.:.|:          ||..|..|..|..||   :.|:|    
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKN----------RIVGGEEAAAGLAPYQISLQGIG---- 51

  Fly    61 GGGTWCGGSIIGNTWVMTAKHCTDGMESVT--IYYGALWRLQAQYTHWVGRSDF-----IEHGS- 117
            .|...|||:||...|::||.|||.|.::..  :..|      .|..|..|...:     :||.: 
  Fly    52 SGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTG------TQDLHQNGSKYYYPDRIVEHSNY 110

  Fly   118 ------GDISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCV 175
                  .||:|:. ...:.|.:....|||    |......|...|::|||..|..|.|...|..:
  Fly   111 APRKYRNDIALLHLNESIVFDNATQPVEL----DHEALVPGSRLLLTGWGTLSLGGDVPARLQSL 171

  Fly   176 DVQIGENSVCENYY-GSFSGDL--ICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCL 237
            :|.......|...: .|...|:  :|....:.:|.|.|||||||| |:| :.|.:|::|  ..|.
  Fly   172 EVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNG-KLVALVNWG--LPCA 232

  Fly   238 SNGPKGMVRVTSYLDWIRDNTGIS 261
            ...|.....::.|.|:||.:..:|
  Fly   233 KGYPDAHASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 69/237 (29%)
Tryp_SPc 41..257 CDD:238113 69/236 (29%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 69/237 (29%)
Tryp_SPc 30..252 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436749
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.