DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG17477

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:241 Identity:80/241 - (33%)
Similarity:107/241 - (44%) Gaps:32/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDG-------MESVT 90
            ::|..|..|..|.||..||.|.|  ....|...|||:||.:.|::||.||..|       :.:.|
  Fly    22 ALEHFIVGGQNAAEGDAPYQVSL--QTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGT 84

  Fly    91 IYY---GALWRLQAQYTHWVGRSDFIEHGSGDISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQG 151
            |.|   ||::...|.|.|....|...::   ||.|:. ...:.|.:|...||||.....    :|
  Fly    85 IRYAEPGAVYYPDAIYLHCNYDSPKYQN---DIGLLHLNESITFNALTQAVELPTSPFP----RG 142

  Fly   152 WWALV-SGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYGSFSGDL------ICIPTPENKGTCS 209
            ...|| :|||..|..|.:...|..|..|...:..||:...::. ||      ||.....|.|.|.
  Fly   143 ASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYE-DLELGPCHICAYRQANIGACH 206

  Fly   210 GDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            |||||||| |.|. .|||::|  ...|....|...:.:..|.||:|
  Fly   207 GDSGGPLV-HQGT-LVGILNF--FVPCAQGVPDIFMNIMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 77/234 (33%)
Tryp_SPc 41..257 CDD:238113 78/233 (33%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 79/236 (33%)
Tryp_SPc 27..246 CDD:214473 76/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.