DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG9649

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:280 Identity:64/280 - (22%)
Similarity:105/280 - (37%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGKAS-IEGR--------ITMGYPAYEGKVPYIVGLGFSKNGG--GTWCGGSIIGNTWVMTAKHC 82
            :|:.| |.||        |..|.....|::|::..| |...|.  ...|||::|....|::|.||
  Fly   239 IGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAAL-FEHVGRDYNFLCGGTLISARTVISAAHC 302

  Fly    83 ---------------TDGMESVTIYYG------ALWRLQAQYTHWVGRSDFIEHGSGDISLIR-T 125
                           :.|..|:.::..      |...:..||...|       :...|::|:: :
  Fly   303 FRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNV-------YTDADLALLQLS 360

  Fly   126 PHVD---------FWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGE 181
            .|||         .|:....:|||         .|..:.|:|||:.......:......|..|..
  Fly   361 NHVDIGDYIKPICLWNENFLLELP---------SGHKSYVAGWGEDEKGNRNTRLAKMTDTDIIT 416

  Fly   182 NSVCENYYGSFSGD--------LICIPTPENKGTCSGDSGGPLVIHDGNRQV--GIVSFGS--SA 234
            ...|.   |:.|.:        .||....:..|.|||||||.|::.:.:..:  |:||.|.  :.
  Fly   417 QWECR---GNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTN 478

  Fly   235 GCLSNGPKGMVRVTSYLDWI 254
            .|....|.....|..:::|:
  Fly   479 RCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 59/269 (22%)
Tryp_SPc 41..257 CDD:238113 58/259 (22%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 58/260 (22%)
Tryp_SPc 259..497 CDD:214473 57/257 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.