DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG13318

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:227 Identity:60/227 - (26%)
Similarity:88/227 - (38%) Gaps:54/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSD---------FIEHG------ 116
            ||::|....|:||.|        .:|...|...:.:...|...|.         :|.:.      
  Fly   190 GGALITAQHVLTAAH--------KVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSF 246

  Fly   117 -----SGDISLIR--TP-HVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYL- 172
                 ..|:::::  || .:...|.|..|.||.     .::.|....|:|||| :|.|....|. 
  Fly   247 NPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPT-----TSFVGQRCWVAGWGK-NDFGATGAYQA 305

  Fly   173 --NCVDVQIGENSVCE------NYYGSF---SGDLICIPTPENKGTCSGDSGGPLVIHDGN--RQ 224
              ..|||.:..|:.|:      ....||   ....||......|..|:||.|.|||.....  ..
  Fly   306 IERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYV 370

  Fly   225 VGIVSFGSSAGCLSNGPKGM-VRVTSYLDWIR 255
            ||:|::|  .||...|..|: |.|.:||.||:
  Fly   371 VGLVAWG--IGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 58/224 (26%)
Tryp_SPc 41..257 CDD:238113 60/227 (26%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 60/227 (26%)
Tryp_SPc 169..399 CDD:214473 58/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.