DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG7542

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:271 Identity:108/271 - (39%)
Similarity:142/271 - (52%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW 65
            ||:|..:||  :.|.||         ||: ...:|..||.|.||..|:.||..||..|.....||
  Fly     2 MKLLVCVLL--VGSCTA---------VPL-LTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTW 54

  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGAL----WRLQAQYTHWVGRSDFIEHGS-------GD 119
            |||::|.:.|::||.||.||.||||:|.||:    ...:.|....|.:|..|.|.:       .|
  Fly    55 CGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVND 119

  Fly   120 ISLIRTP-HVDFWSLVNKVELP-RYDDRYNNYQGWWALVSGWGKTSD-EGGVSEYLNCVDVQIGE 181
            |||||.| .|.|...:....|| |.:.::..|:...|..||||:.|| ...||..|..|::.|..
  Fly   120 ISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMP 184

  Fly   182 NSVCENYY-GSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQ--VGIVSFGSSAGCLSNGPKG 243
            :|:|..|: |:.|..:||:.|...|.||.||||||||...||..  :|..|||:|.||....|..
  Fly   185 HSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAV 249

  Fly   244 MVRVTSYLDWI 254
            ..|::||||||
  Fly   250 FTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 95/233 (41%)
Tryp_SPc 41..257 CDD:238113 95/231 (41%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 97/234 (41%)
Tryp_SPc 27..260 CDD:214473 95/232 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470920
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
99.000

Return to query results.
Submit another query.