DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG11529

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:280 Identity:90/280 - (32%)
Similarity:130/280 - (46%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAVLLLGVIASATAFEKPVFWKDVP-----VGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGG 63
            |||::|            :.||..|     ||::.. |||.        |.||.|.|    .|..
  Fly    12 LAVIML------------MMWKPTPTDSYAVGQSKY-GRIE--------KFPYQVML----IGKQ 51

  Fly    64 TW-----CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVG----RSD-FIEH--- 115
            .|     |||:::...|::||.|||.|:....:|.|.   ...:.|...|    ||: ||.|   
  Fly    52 LWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGT---KSVEDTEVSGGLVLRSNKFIVHERF 113

  Fly   116 ----GSGDISLIRTPH-VDFWSLVNKVELP-RYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNC 174
                .:.||:|::.|. |.|...:....|| ||  |::.:.|...:.||||...:... |:.:..
  Fly   114 NPETAANDIALVKLPQDVAFTPRIQPASLPSRY--RHDQFAGMSVVASGWGAMVEMTN-SDSMQY 175

  Fly   175 VDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSN 239
            .::::..|:.|...|...:..:||....:::..|:||||||||:.|....|||.|||.:.||.:|
  Fly   176 TELKVISNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETN 240

  Fly   240 GPKGMVRVTSYLDWIRDNTG 259
            .|.|..|||.|||||....|
  Fly   241 IPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 77/235 (33%)
Tryp_SPc 41..257 CDD:238113 77/234 (33%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 79/238 (33%)
Tryp_SPc 37..255 CDD:214473 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
87.930

Return to query results.
Submit another query.