DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG18180

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:270 Identity:120/270 - (44%)
Similarity:153/270 - (56%) Gaps:14/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNG--GG 63
            ||:..:.|...:|...|  .|.......:.....||||..||||.|||.||||||....:|  .|
  Fly     1 MKLFLLTLSAALALVAA--SPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSG 63

  Fly    64 TWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEH------GSGDISL 122
            ....|:||.|.|::||.||..| :.|.|:||:.|.....|...|.|.:||.|      |..||.|
  Fly    64 AVGAGTIIANDWILTAAHCLTG-DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGL 127

  Fly   123 IRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCEN 187
            ||||||||..|:||:.||..:::.:.||..|.:..||| ..|.|.::::|.||||||..||.||.
  Fly   128 IRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWG-GMDNGNLADWLQCVDVQIISNSECEQ 191

  Fly   188 YYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLD 252
            .|||.:...:|....:.|..|.||||||||.||..|.||:::| :|..| .:||.|..||:.||:
  Fly   192 AYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITF-ASVSC-HDGPSGYTRVSDYLE 254

  Fly   253 WIRDNTGISY 262
            ||||.|||||
  Fly   255 WIRDQTGISY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 103/224 (46%)
Tryp_SPc 41..257 CDD:238113 104/223 (47%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 103/224 (46%)
Tryp_SPc 36..259 CDD:238113 105/226 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.