DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG18179

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:275 Identity:119/275 - (43%)
Similarity:158/275 - (57%) Gaps:20/275 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLL---LGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGG 62
            ||:..:.|   |.|:|::..|.:......|.:.:.: ||||..||||.|||.||||||....:|.
  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGA-EGRIVNGYPAPEGKAPYIVGLLIRTDGS 64

  Fly    63 GTWC--GGSIIGNTWVMTAKHC--TDGMESVTIYYGALWRLQAQYTHWVGRSDFIEH------GS 117
            .:..  .|:||.:.|::||.||  ||.:|   |:||:.|.....:...|.|.:||.|      |.
  Fly    65 NSAAVGAGTIIASDWILTAAHCLTTDYVE---IHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGG 126

  Fly   118 GDISLIRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGEN 182
            .||.|||||.|.|..|:|||.||.:.:..:.:...|.:..||| ..|.|.::::|.|:||||..|
  Fly   127 RDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWG-GMDNGNLADWLQCMDVQIISN 190

  Fly   183 SVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRV 247
            |.||..||:.:...:|....:.|.:|.||||||||.||..|.||:::|| |..|.| ||.|..||
  Fly   191 SECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFG-SVDCHS-GPSGYTRV 253

  Fly   248 TSYLDWIRDNTGISY 262
            |.||.||||||||||
  Fly   254 TDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 99/226 (44%)
Tryp_SPc 41..257 CDD:238113 100/225 (44%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 99/226 (44%)
Tryp_SPc 40..263 CDD:238113 101/228 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470769
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.