DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG3088

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:268 Identity:111/268 - (41%)
Similarity:157/268 - (58%) Gaps:22/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLL-LGVIASATA---FEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNG 61
            ||:|.|.| |.::|:.:|   .|.|             :..||.|.|||||:.||:||:.|.:: 
  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDP-------------DHIITNGSPAYEGQAPYVVGMAFGQS- 51

  Fly    62 GGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGSGDISLIRTP 126
             ..||.|:|||:||::|:..|..|...||||:||....|||:|..||.|:::. |:..::|:|.|
  Fly    52 -NIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVT-GNQHLALVRVP 114

  Fly   127 HVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYGS 191
            .|.|.:.||:|.||...:|...|:.|||.|.|||.|:...|:::.|.|||:||..|:.|..:|||
  Fly   115 RVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGS 179

  Fly   192 --FSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
              .|..::|..||..:.||.||:|.||:....:..|||.:|.:|.||....|.|..|:||.||||
  Fly   180 TTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWI 244

  Fly   255 RDNTGISY 262
            ...|||:|
  Fly   245 HQRTGIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 95/218 (44%)
Tryp_SPc 41..257 CDD:238113 95/217 (44%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 97/219 (44%)
Tryp_SPc 29..244 CDD:214473 95/217 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470795
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.