DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and sphinx2

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:273 Identity:70/273 - (25%)
Similarity:122/273 - (44%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKN------- 60
            |:|:|:|.:..|...             |..:..|||.||.|....:.|:||:.::|:       
  Fly     4 VVALLVLSLTFSVCE-------------KNKLSPRITGGYRAKPYTIIYLVGIVYAKSPLSSLKF 55

  Fly    61 GGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYG---ALWRLQAQYTHWVGRSDFIEH--GSGDI 120
            |.||     ||.|.|::|.|.... .:.:..::|   |.|.......:   |.:|..|  .:..|
  Fly    56 GAGT-----IISNQWILTVKEVLI-FKYIEAHFGSKRAFWGYDILRIY---RENFYFHYDKTRII 111

  Fly   121 SLIRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVC 185
            :|::.|:..|...:::|.:|.|..|:..|.|...:|.|||....:..:..::.||:|::..|:.|
  Fly   112 ALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCVEVEVMNNTEC 176

  Fly   186 ENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQ-VGIVSFGSSAGCLSNGPKGMVRVTS 249
            ..|:.......:|......||.|.||.||.:|....|.. :||: :.....|....|...:||:.
  Fly   177 AKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII-WLMPTNCSIGYPSVHIRVSD 240

  Fly   250 YLDWIRDNTGISY 262
            ::.||:..:|:.:
  Fly   241 HIKWIKHVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 61/229 (27%)
Tryp_SPc 41..257 CDD:238113 60/228 (26%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 61/229 (27%)
Tryp_SPc 26..248 CDD:304450 62/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.