DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG10472

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:282 Identity:111/282 - (39%)
Similarity:142/282 - (50%) Gaps:31/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLGVIASATAFEKPVFWKDV-------PVGKASIE----GRITMGYPAYEGKVPYIVGLGFSK 59
            ||||..|..|.|    |.|..|       |:.|...|    ||||.|..|...:.||.|||....
  Fly     8 VLLLATILGAQA----VDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYI 68

  Fly    60 NGGGTWCGGSIIGNTWVMTAKHCTDGMES-VTIYYGALWRLQA----QYTHWVGRSDFIEHG--- 116
            .||..||||:||.:.|::||.||||.:.: |.:|.||..|..|    |...:|...:.|.|.   
  Fly    69 TGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWI 133

  Fly   117 ----SGDISLIRTP-HVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEG-GVSEYLNCV 175
                :.|||||:.| .::|...:...:||...|.|:.|.|..|:.|||||.||.. |.::.|...
  Fly   134 AETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYA 198

  Fly   176 DVQIGENSVCEN-YYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDG-NRQVGIVSFGSSAGCLS 238
            .|.|..||.|.. |:|..:...|||.|.....||:||||||||:.|| |..:|..|||.:.||..
  Fly   199 TVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEV 263

  Fly   239 NGPKGMVRVTSYLDWIRDNTGI 260
            ..|....|:|.|||||.:.:|:
  Fly   264 GWPGVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 94/232 (41%)
Tryp_SPc 41..257 CDD:238113 93/231 (40%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 94/232 (41%)
Tryp_SPc 47..282 CDD:238113 95/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470898
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.