DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG15873

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:118/289 - (40%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVG------KASIEGRITMGYPAYEGKVP-YIVGLGFS 58
            |::|.| .||:|.|.:.       .|..:|      ..:.|..|:.||.....::. ::|.:. :
  Fly     1 MQILTV-FLGLILSTSL-------SDADLGVIGDISDETFEMLISGGYKPKSNRLSRHVVSIR-T 56

  Fly    59 KN-----GGGTWCGGSIIGNTWVMTAKHC-TDGMES------VTIYYGALWRLQAQYTHWVGRS- 110
            ||     |...:|.|.::.:..|:||.|| ||..::      :.:.:|.:.|| |.|.....|| 
  Fly    57 KNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRL-AVYDESDFRSV 120

  Fly   111 -------DFIEHGSGDISLIRTPHVDFWSLVNKVELPRYD-------DRYNNYQGWWALVSGWGK 161
                   ::..:...|::::|        |..:|:...:|       ...|...|...:..|||:
  Fly   121 DRLVVHPEYERYKKNDLAILR--------LSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQ 177

  Fly   162 TSDEGGVSEYLNCVDVQIGENSVCENYYGSFSGD-LICIPTPENKGTCSGDSGGPLVIHDGNRQV 225
            ....|..|..|..:||.:...|:|:.:|.:|:.| .:|.........|:||.||||:..  ....
  Fly   178 IYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCK--GALF 240

  Fly   226 GIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
            |::  |...||........:....|.|||
  Fly   241 GLI--GGHMGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 57/245 (23%)
Tryp_SPc 41..257 CDD:238113 58/243 (24%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 54/227 (24%)
Tryp_SPc 59..250 CDD:238113 48/203 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.