DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG13527

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:227 Identity:67/227 - (29%)
Similarity:101/227 - (44%) Gaps:51/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRL-------QAQYTHWVGRS-------- 110
            |...:|||.::.|.||:||.||..|...  |.|.|.|.|       :.:||  .|:|        
  Fly    57 GDNHYCGGGLLSNQWVITAAHCVMGQSK--IMYKARWLLVVAGSPHRLRYT--PGKSVCSPVSSL 117

  Fly   111 ----DFIEHGSGDISLIR--------TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTS 163
                :|..|.:.:::|::        .|.:.|..|..  |.|:...|:.        |.|||:..
  Fly   118 YVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPK--EAPKIGIRHT--------VLGWGRMY 172

  Fly   164 DEGGVSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGT-----CSGDSGGPLVIHDGNR 223
            ..|.::.::..|||.:.:|:||:.|:..:...::|  ...|..|     ||||.|.||:  .|..
  Fly   173 FGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMC--AGNNNWTIDAEPCSGDIGSPLL--SGKV 233

  Fly   224 QVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            .||||::....|| :|.|.....|.|.|.|||
  Fly   234 VVGIVAYPIGCGC-TNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 64/224 (29%)
Tryp_SPc 41..257 CDD:238113 67/227 (30%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 67/227 (30%)
Tryp_SPc 43..263 CDD:214473 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.