DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30283

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:117/284 - (41%) Gaps:71/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGS 69
            :|::|| ..|.:..|.|.  ..||:.:..|.|    |:.|.....|:   :......||..|||:
  Fly    17 SVVVLG-SESGSFLEHPC--GTVPISQFKILG----GHNAPVASAPW---MAMVMGEGGFHCGGT 71

  Fly    70 IIGNTWVMTAKHCTDGMESVTIYYGALWR--------LQAQYTHWVGRSD--FIEHGSGDISLIR 124
            :|.|.:|:|:.||....| :.:..|.|.|        :.|.:.|    :|  |.:|   |::|:|
  Fly    72 LITNRFVLTSAHCIANGE-LKVRLGVLEREAEAQKFAVDAMFVH----TDYYFDQH---DLALLR 128

  Fly   125 TPHVDFWS------------LVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDV 177
            ......:|            ||..::  .:..::..|        |||||..... |..|....:
  Fly   129 LAKRVHYSDNISPICLLLDPLVKNID--EHIVKFRTY--------GWGKTESRSS-SRMLQKTSL 182

  Fly   178 QIGENSVCENYY--GSFSGDLICIPTPENKGTCSGDSGGPL---VIHDGNR---QVGIVSFG--- 231
            .....|.|...|  ...:.:.||..: .|..||:|||||||   |.:|..:   |.|:.|||   
  Fly   183 FNLHRSECAKQYPHQQINRNHICAES-ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHAD 246

  Fly   232 -SSAGCLSNGPKGMVRVTSYLDWI 254
             |.|...:|       |.::||||
  Fly   247 CSKATVFTN-------VMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 65/250 (26%)
Tryp_SPc 41..257 CDD:238113 67/248 (27%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 67/254 (26%)
Tryp_SPc 43..266 CDD:238113 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.