DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG10764

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:117/276 - (42%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCG 67
            :::|.||.::.......:...:.:.|.| .|...:|:.|..|.|   |..:.:....|.....||
  Fly     4 LVSVALLSLLTLCVTENEHFKFLETPCG-ISTRPKISGGDDAAE---PNSIWMAAIFNSSDFQCG 64

  Fly    68 GSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHG------SGDISLIRTP 126
            |:||...:|::|.||......:.:..||....:....|.| .:.|:.|.      ..||.|::..
  Fly    65 GTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTV-INVFVHHDFIASEYRNDIGLLQLS 128

  Fly   127 HVDFWSLVNKVEL--------PRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENS 183
            .    |:|..|.:        |.........:.:.||  |||..:  |.:|..|..:.:...:.:
  Fly   129 E----SIVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWGNRN--GKLSIMLQTIYLLHLKRN 185

  Fly   184 VCE---NYYGSFSGDLICIPTPENKGTCSGDSGGPL---VIHDGNR----QVGIVSFGSSAGCLS 238
            .|:   |:  :.:...||..| :|..||.|||||||   ::...|:    |:||||||... |  
  Fly   186 ECKRKLNF--NLNSRQICAGT-KNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPE-C-- 244

  Fly   239 NGPKGMVRVTSYLDWI 254
            .|......||||:|||
  Fly   245 RGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 66/240 (28%)
Tryp_SPc 41..257 CDD:238113 67/238 (28%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 66/240 (28%)
Tryp_SPc 38..263 CDD:238113 68/241 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.