DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Ctrc

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:284 Identity:74/284 - (26%)
Similarity:119/284 - (41%) Gaps:59/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW---CGG 68
            :|..::|.|:....|.|       ..::..|:..|..|.....|:.|.|.:.|:  .||   |||
  Rat     6 VLAAILACASCCGNPAF-------PPNLSTRVVGGEDAVPNSWPWQVSLQYLKD--DTWRHTCGG 61

  Fly    69 SIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDF---IEHGSGDI-SLIRTPHVD 129
            |:|..:.|:||.||                :...:|:.||...:   :|...|.: :.:.|.:|.
  Rat    62 SLITTSHVLTAAHC----------------INKDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVH 110

  Fly   130 -------FWSLVNKVELPRYDDRYNNY-------------QGWWALVSGWGKTSDEGGVSEYLNC 174
                   .|:.:..::|....:..|..             |.:...|:|||:....|.::|.|..
  Rat   111 EKWNRLFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLLPQDYPCYVTGWGRLWTNGPIAEVLQQ 175

  Fly   175 VDVQIGENSVCEN---YYGSFSGDLICIPTPENKGTCSGDSGGPL--VIHDGNRQV-GIVSFGSS 233
            ....|..::.|..   ::......::|.........|:|||||||  ...||:.|| ||||||||
  Rat   176 GLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSS 240

  Fly   234 AGC-LSNGPKGMVRVTSYLDWIRD 256
            :|| :...|....||::|.|||.:
  Rat   241 SGCNVHKKPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 67/250 (27%)
Tryp_SPc 41..257 CDD:238113 68/250 (27%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 67/250 (27%)
Tryp_SPc 30..265 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.