DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG12133

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:104/279 - (37%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GKASIEGRITMGYPAYEGKVPYIVGLGF----SKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVT 90
            |::.....|..|..|...:.|:.|.||:    :|......|.||:|.:.:|:||.||.    :|.
  Fly    54 GQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL----NVN 114

  Fly    91 IYYGALWRL-------QAQYTHWVGRSDFI---EHGSGDISLIRTPHVDFWSL----VNKVELPR 141
            .:|.|..||       ...|| |:.....|   .|...|:.| |.||..:::.    .|.:.|.|
  Fly   115 DFYVARVRLGEHDTENDPDYT-WLPNGAKIWAPAHVDIDVDL-RVPHEQYYTRNGRHYNDIALLR 177

  Fly   142 YDDRY-------------------NNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSV--- 184
            ...|.                   ::::.:...::|||   |.|     |......:.:.::   
  Fly   178 LKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWG---DSG-----LQQKSTVLRQGTISGM 234

  Fly   185 ----CENYYGSFSGD---LICIPTPENKGTCSGDSGGPLVIHDGNRQ------VGIVSFGSSAGC 236
                |.|.|.:...|   .||....:...|..||||.||:...|...      .||.|:|.....
  Fly   235 SPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSS 299

  Fly   237 LSNGPKGMVRVTSYLDWIR 255
            ...||....:.:||.:||:
  Fly   300 YGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 64/269 (24%)
Tryp_SPc 41..257 CDD:238113 65/268 (24%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 66/271 (24%)
Tryp_SPc 62..317 CDD:214473 64/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.