DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Jon44E

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:268 Identity:169/268 - (63%)
Similarity:195/268 - (72%) Gaps:15/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAVLLLGVIASATAFEKPVFWKDVP-VGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCG 67
            |||...||:.|.:|...||  ||:| .||  ||||||.||||||||:||||||.|  |.||.|||
  Fly    10 LAVASAGVVPSESARAVPV--KDMPRAGK--IEGRITNGYPAYEGKIPYIVGLSF--NDGGYWCG 68

  Fly    68 GSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHG------SGDISLIRTP 126
            ||||.:|||:||.|||:....|.||:||.:|.:|||||||.|||.|:|.      :.||:|||.|
  Fly    69 GSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRIP 133

  Fly   127 HVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYGS 191
            ||||||||||||||.|:||||:|.||||:.||||.|.:..|:|.|||||||||.:|:.|.|||||
  Fly   134 HVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGS 198

  Fly   192 --FSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
              .:.:.|||.|...|.:||||||||||:||.||.||||||||..||.:..|.|..|||.|||||
  Fly   199 NYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263

  Fly   255 RDNTGISY 262
            ||:|||.|
  Fly   264 RDHTGIVY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 144/224 (64%)
Tryp_SPc 41..257 CDD:238113 144/223 (65%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 144/224 (64%)
Tryp_SPc 41..266 CDD:238113 146/226 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470689
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.