DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and try-9

DIOPT Version :10

Sequence 1:NP_648015.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:48 Identity:16/48 - (33%)
Similarity:23/48 - (47%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GDLICIPTPENKG-TCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNG 240
            |.:.| .:..|:| :|.||||..:|.....|.|.::     .|.||.|
 Worm   193 GGVYC-TSAVNRGLSCDGDSGSGVVRTSDTRNVQVL-----VGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_648015.1 Tryp_SPc 37..254 CDD:214473 16/48 (33%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:473915 16/48 (33%)

Return to query results.
Submit another query.