DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and scaf

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:252 Identity:58/252 - (23%)
Similarity:94/252 - (37%) Gaps:55/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSI 70
            |.|.||.|:.....||...||:....|.|..:..:                ..::.....|||:|
  Fly   406 VNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMI----------------LRESSKTLICGGAI 454

  Fly    71 IGNTWVMTAKHCTDGMESVTIYYGA-LWRLQA-------QYTHWVGRSDFIEH-------GSGDI 120
            ||:.:|:::..|.:|:....|...| .|.|.:       |.|   |......|       .|.|:
  Fly   455 IGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLT---GVKTVDVHPDYDPSTNSHDL 516

  Fly   121 SLIRTP-HVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTS----DEGGVSEYLNCVDVQIG 180
            ::||.. .::|.|.:..:.:...|.:.:..    ...|||||.:    :||.:   ::..|....
  Fly   517 AIIRLERRLEFASHIQPICISDEDPKDSEQ----CFTSGWGKQALSIHEEGAL---MHVTDTLPQ 574

  Fly   181 ENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGN--RQVGIVSFGSSAG 235
            ..|.|     |.....:|..|..:  :|..|.|..|....|:  |..||.:..:|.|
  Fly   575 ARSEC-----SADSSSVCSATKFD--SCQFDVGSALACGSGSSVRLKGIFAGENSCG 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 47/221 (21%)
Tryp_SPc 41..257 CDD:238113 47/217 (22%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 45/220 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.