DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and PRSS48

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:269 Identity:78/269 - (28%)
Similarity:106/269 - (39%) Gaps:58/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYG 94
            |:.....|:..|..|..|:.|:.|.|.|..|   ..||||::....::||.||..          
Human    43 GQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN---FICGGSLVSERLILTAAHCIQ---------- 94

  Fly    95 ALWRLQAQYTHWVGR--------------SDFIEH-----GSGDISLIR-TPHVDFWSLVNKVEL 139
            ..| ....||.|:|.              |..:.|     .:.|::|:: :..|.|.|.:..:.|
Human    95 PTW-TTFSYTVWLGSITVGDSRKRVKYYVSKIVIHPKYQDTTADVALLKLSSQVTFTSAILPICL 158

  Fly   140 PRYDDRYNNYQGWWALVSGWGKTSDEGGVSEY---LNCVDVQIGENSVCENYY---GSF------ 192
            |....:.......|  |:||||.. |....:|   |...:|.|.:...||..|   |.|      
Human   159 PSVTKQLAIPPFCW--VTGWGKVK-ESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEP 220

  Fly   193 --SGDLICIPTPEN-KGTCSGDSGGPLVIH-DGN-RQVGIVSFGSSAGCLSNGPKGMVRVTSYLD 252
              ..|.||....:| |.:|.|||||||..| ||. .|.|:||:|...|  .:.|.....|..|..
Human   221 VIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLECG--KSLPGVYTNVIYYQK 283

  Fly   253 WIRDNTGIS 261
            ||  |..||
Human   284 WI--NATIS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 72/253 (28%)
Tryp_SPc 41..257 CDD:238113 73/252 (29%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 72/253 (28%)
Tryp_SPc 51..288 CDD:238113 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.