DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and prss60.3

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:261 Identity:83/261 - (31%)
Similarity:117/261 - (44%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVT--IY 92
            |:|.:..||..|..|..|..|:.|.| .|...||.:||||:|.:.||:||.||..|:...|  :|
Zfish    28 GQAPLNTRIVGGVNASPGSWPWQVSL-HSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVY 91

  Fly    93 YGALWRLQA-----QYTHWVGRSDFIEHGS-------GDISLIR-TPHVDFWSLVNKVELPRYDD 144
            .|.  |.|.     :.:..|.:| |: |.|       .||:|:| :..|.|.:.:..|.|...:.
Zfish    92 LGR--RTQQGINIYETSRNVAKS-FV-HSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNS 152

  Fly   145 RYNNYQGWWALVSGWGKTSDEGGVS----EYLNCVDVQIGENSVCENYYGS--FSGDLICIP-TP 202
            .|:.....|  ::|||..  :.||:    ..|....:.:..|..|....||  .:.::||.. |.
Zfish   153 VYSAGTSSW--ITGWGDI--QAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQ 213

  Fly   203 ENKGTCSGDSGGPLVIHDGNR------QVGIVSFGSSAGCLS-NGPKGMVRVTSYLDWIRDNTGI 260
            ..|.||.||||||:|    .|      |.||.|:|  .||.. |.|....||:.|..||.....:
Zfish   214 GGKDTCQGDSGGPMV----TRLCTVWVQAGITSWG--YGCADPNSPGVYTRVSQYQSWISSKISL 272

  Fly   261 S 261
            :
Zfish   273 N 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 79/245 (32%)
Tryp_SPc 41..257 CDD:238113 79/244 (32%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 80/247 (32%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.