DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and sphe

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:120/276 - (43%) Gaps:60/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSI 70
            :::||:| ..||           ||....:|||..|..|......:...|   :......|||||
  Fly     6 LVILGLI-GLTA-----------VGMCHAQGRIMGGEDADATATTFTASL---RVDNAHVCGGSI 55

  Fly    71 IGNTWVMTAKHCT--DG--MESVTIYYGALWRLQAQYTHWVGRSDFIEHGSGDISLIRT--PHVD 129
            :..|.::|..||.  ||  :::.        ||..:    ||.::  ::..|.|..:.:  .|.|
  Fly    56 LSQTKILTTAHCVHRDGKLIDAS--------RLACR----VGSTN--QYAGGKIVNVESVAVHPD 106

  Fly   130 FWSLVNKV-------ELPRYDDRYNNY-----------QGWWALVSGWGKTSDEGGVSEY-LNCV 175
            :::|.|.:       || .|.||....           :|...:|:|||:|||  |.:.| :..:
  Fly   107 YYNLNNNLAVITLSSEL-TYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSD--GTNSYKIRQI 168

  Fly   176 DVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNG 240
            .:::...:.|.:.|........|:.....:|||.||.||..:.  ||..:|:.:|...| |.|..
  Fly   169 SLKVAPEATCLDAYSDHDEQSFCLAHELKEGTCHGDGGGGAIY--GNTLIGLTNFVVGA-CGSRY 230

  Fly   241 PKGMVRVTSYLDWIRD 256
            |...||::||.|||::
  Fly   231 PDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 64/241 (27%)
Tryp_SPc 41..257 CDD:238113 64/241 (27%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/228 (27%)
Tryp_SPc 42..244 CDD:214473 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.