DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG8952

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:278 Identity:88/278 - (31%)
Similarity:141/278 - (50%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW----CG 67
            |:|.::|:.:...:|  :.........|:.||..|..|..|:.|:.|.|     ....|    ||
  Fly     9 LMLVLLAAISVVGQP--FDPANSSPIKIDNRIVSGSDAKLGQFPWQVIL-----KRDAWDDLLCG 66

  Fly    68 GSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRS-----DFIEHGSGDISLIRTPH 127
            ||||.:|||:||.|||:|:.|:.:.:|.:....|...:....:     |:.:..:.|:|||:.|.
  Fly    67 GSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDKLNNDVSLIQLPE 131

  Fly   128 -VDFWSLVNKVEL-PRYDDRYNNYQGWWALVSGWGKTSDEG-GVSEYLNCVDVQIGENSVCENYY 189
             :.|.:.:..::| .:|.|.. :|.|..|.::|:|.|.||. ..||.|....|:|.:|:.|...|
  Fly   132 PLTFSANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIY 195

  Fly   190 GSFSGDLICIPTPENKG-------TCSGDSGGPLVIHDGN----RQVGIVSFGSSAGCLSNGPKG 243
            |.:   ::...|...||       ||:|||||||::::..    :|:||.||.:...|....|.|
  Fly   196 GKY---VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSG 257

  Fly   244 MVRVTSYLDWIRDNTGIS 261
            ..||:|:|.:|.|.|||:
  Fly   258 YARVSSFLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 78/239 (33%)
Tryp_SPc 41..257 CDD:238113 77/238 (32%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 78/239 (33%)
Tryp_SPc 38..271 CDD:238113 78/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471035
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.