DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and sphinx1

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:122/283 - (43%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVG-KASIEGRITMGYPAYEGKVPYIVGLGF--SKNGG 62
            ||::..||   :.|.|          |.|| |..:..||..||.|....:.|:||:.:  |:...
  Fly     1 MKLVVTLL---VLSLT----------VSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSS 52

  Fly    63 GTWCGGSIIGNTWVMTAK----------HCTD-----GMESVTIYYGALWRLQAQYTHWVGRSDF 112
            ..:..|:||.|.|::|.|          |...     |.:.:.||                :.:|
  Fly    53 LNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIY----------------KENF 101

  Fly   113 IEHGSGD--ISLIRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCV 175
            ..|...|  |:|::.|:..|...:::|.:|.||.|:..|.|...:|.|:|.......:.|::.|:
  Fly   102 RFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCI 166

  Fly   176 DVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQ-VGIVSFGSSAGCLSN 239
            :|::..|:.|..||.......:|......||.|.||.||.:|....|.. :||: :.....|...
  Fly   167 EVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIG 230

  Fly   240 GPKGMVRVTSYLDWIRDNTGISY 262
            .|...:||:.::.||:..:|:.:
  Fly   231 YPSVHIRVSDHIKWIKRVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 60/236 (25%)
Tryp_SPc 41..257 CDD:238113 60/235 (26%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 60/236 (25%)
Tryp_SPc 26..248 CDD:304450 61/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.