DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and C1s2

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_776289.2 Gene:C1s2 / 317677 MGIID:3644269 Length:694 Species:Mus musculus


Alignment Length:279 Identity:72/279 - (25%)
Similarity:108/279 - (38%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTI 91
            ||.....::.:|..|.||.....|:.|......      .||::|...||:||.|..:.....::
Mouse   433 VPTEPFQVQQKIFGGQPAKIENFPWQVFFNHPT------AGGALINEYWVLTAAHVVEKNSDPSM 491

  Fly    92 YYGA-------LWRLQAQYTHWV-------------GRSDFIEHGSGDISLIRTPH-VDFWSLVN 135
            |.|.       |...|..||..|             .|::|    ..||:|::... |......:
Mouse   492 YAGITALRLADLENAQRLYTKRVIIHPGWKEDDDLNPRTNF----DNDIALVQLKDPVKMGPKFS 552

  Fly   136 KVELPRYDDRYNNYQGWWALVSGWGKTSD-------EGG---VSEYLNCVDVQIGENSVC--ENY 188
            .:.||.....||...|...|:||||:|..       .|.   |:....|..|: .||...  |:|
Mouse   553 PICLPGTSSEYNLSPGDMGLISGWGRTEKRLHVINLRGAKVPVTSLETCKQVK-EENPTARPEDY 616

  Fly   189 YGSFSGDLICIPTPENKG--TCSGDSGGPLVIHDGNRQ------VGIVSFGSSAGCLSNGPKGM- 244
            .  .:.::||   ...||  :|.|||||.......|.:      .|:||:|...|..     |: 
Mouse   617 V--ITDNMIC---AGEKGVDSCKGDSGGAFAFQVPNVKAPKFYVAGLVSWGKKCGAY-----GVY 671

  Fly   245 VRVTSYLDWI----RDNTG 259
            .:|.:|:|||    ::|:|
Mouse   672 TKVKNYVDWILKTMQENSG 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 66/258 (26%)
Tryp_SPc 41..257 CDD:238113 67/261 (26%)
C1s2NP_776289.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:291342
CUB 181..293 CDD:278839
CCP 300..361 CDD:153056
CCP 365..428 CDD:153056
Tryp_SPc 443..681 CDD:214473 66/258 (26%)
Tryp_SPc 444..684 CDD:238113 68/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.