DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Prss34

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:259 Identity:80/259 - (30%)
Similarity:110/259 - (42%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITMGYPAYEGKVPYIVGLGFSKNGGGTW---CGGSIIGNTWVMTAKHCTD--GMESVTIYYGALW 97
            |..|.|....:.|:.|.|.|.......|   ||||:|...||:||.||.:  .||:      :.:
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEA------SCF 91

  Fly    98 RLQAQYTHWVGR------------SDFIEH----------GSGDISLIRTPH-VDFWSLVNKVEL 139
            |:|      ||:            :..|.|          |..||:|::... |.....|:.|.|
  Rat    92 RVQ------VGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSL 150

  Fly   140 PRYDDRYNNYQGWWALVSGWGKTSDEGGVSE--YLNCVDVQIGENSVCENYYGSFSG-------- 194
            |....|.::.:.||  |:|||.......:..  :|..|.|.|..||.||..|.::|.        
  Rat   151 PAASQRISSKKTWW--VAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKII 213

  Fly   195 --DLICIPTPENKGTCSGDSGGPLVIHDGNR--QVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
              |::|... |.:.:|..|||||||......  |||:||:|...| |.:.|....||.|||.||
  Rat   214 KDDMLCAGM-EGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCG-LPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 78/257 (30%)
Tryp_SPc 41..257 CDD:238113 79/256 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 80/259 (31%)
Tryp_SPc 33..275 CDD:214473 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.