DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG18420

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:112/288 - (38%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVF----WKDVPVGKAS---IEGRITMGYPAYEGKVPYIVGLGFS 58
            |:::.:.:..::...|.|  |:.    :.|...|..|   :..||..|..|.....|::..|..|
  Fly     1 MEIVVIGMASILLLLTVF--PLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTS 63

  Fly    59 KNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQY--THWVGRSDFIEH------ 115
            .|  ...|||::|....|:||.||.....::.:..|...|....|  .|.|.|:  .:|      
  Fly    64 SN--QFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRT--FQHRFYDPN 124

  Fly   116 -GSGDISLIR-----------TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGV 168
             .:.||:|:|           .|....|....|    .:.|......|     :|||:|......
  Fly   125 THANDIALLRLVSNVVYKANIRPICIMWDASWK----HHIDSIKVLTG-----TGWGRTESMHDS 180

  Fly   169 SEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPL--VIHDGNR----QVGI 227
            || |..:|:....:.:|.  :||...:..|... .|...|.||:|||:  ::...|.    ||||
  Fly   181 SE-LRTLDISRQPSKMCA--FGSVLSNQFCAGN-WNSNLCIGDTGGPVGAMVRYRNAFRFVQVGI 241

  Fly   228 VSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            ..  ::..|  ..|.....|.|::::||
  Fly   242 AI--TNKRC--QRPSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 61/242 (25%)
Tryp_SPc 41..257 CDD:238113 61/241 (25%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 61/242 (25%)
Tryp_SPc 43..267 CDD:238113 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.