DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG33462

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:254 Identity:52/254 - (20%)
Similarity:106/254 - (41%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYY 93
            :.:.|:..::...        |::..|...|   |..|.|::|.:.:|:||.||......:|:..
  Fly    35 ISERSVNAKLAQN--------PWMAYLETPK---GFHCSGTLINHLFVLTAAHCVPDDLLITVRL 88

  Fly    94 GAL-WRLQAQYTHWVGRSDFIEHG---------------SGDISLIRT-PHVDFWSLVNKVEL-- 139
            |.. .:.:....:.:.:..|.|:.               :.||.::|. ..|::.:.:..:.:  
  Fly    89 GEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA 153

  Fly   140 -PRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYG-SFSGDLICIPTP 202
             .|:.:..:  |..|...:.|.:|: ....|:.|..:::.......|...|| :.:.:.||....
  Fly   154 SNRFQEPID--QLTWFTTTVWRETA-ANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNT 215

  Fly   203 ENKGTCSGDSGGPLV---IHDGNR---QVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            .:: .||.|||.|.:   .|:|:.   |:||.| .....|.::|.  ::.:.||.|||:
  Fly   216 LSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIAS-RVKGQCQNSGI--LMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 49/243 (20%)
Tryp_SPc 41..257 CDD:238113 51/242 (21%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 51/233 (22%)
Tryp_SPc 48..269 CDD:214473 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.