DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Sp212

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:280 Identity:61/280 - (21%)
Similarity:100/280 - (35%) Gaps:103/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EGK-VPYIVGLGFSKNGGGTW---------------CGGSIIGNTWVMTAKHCTDGMESVTIYYG 94
            ||. .|:||.......|...|               |.||:|.::.|::|.||...|....:..|
  Fly   270 EGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVG 334

  Fly    95 ALWRLQAQYTHWVGRSDFIEHG------------------------SGDISLIRTPH-VDFWSLV 134
                        :||.|..::|                        ..||:||.... |.|..::
  Fly   335 ------------LGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDII 387

  Fly   135 NKVELPRYDDRYNNYQGWWAL-----------VSGWGKTSDEGGVSEYLNCVDVQIGENSVCENY 188
            ..:.:             |.:           ::|||:..|... ::|...|:.:|...:||.: 
  Fly   388 APICM-------------WTVEASRTVSTTGFIAGWGRDEDSSR-TQYPRVVEAEIASPTVCAS- 437

  Fly   189 YGSFSGDLI-----CIPTPENKGTCSGDSGGPLVIHDGNRQV--GIVSFGSSAGCLSNGPKGMVR 246
              ::.|.::     |....:..|.|.|||||.|::..|:|.:  ||||.|      ..||.|..:
  Fly   438 --TWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAG------ERGPAGTCQ 494

  Fly   247 VTSY---------LDWIRDN 257
            :..|         ::||.:|
  Fly   495 LNQYVLYCDLSKHINWISEN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 58/275 (21%)
Tryp_SPc 41..257 CDD:238113 60/278 (22%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 57/271 (21%)
Tryp_SPc 277..511 CDD:214473 55/268 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.