DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Tpsg1

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:251 Identity:76/251 - (30%)
Similarity:104/251 - (41%) Gaps:49/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GYPAYEGKVPYIVGLGFSKNGGGTW-------------CGGSIIGNTWVMTAKHCTDGMESVTIY 92
            |:|........||| |.:. ..|||             ||||::...||:||.||..|..:.:.|
Mouse    76 GHPQVSNSGSRIVG-GHAA-PAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDY 138

  Fly    93 YGALWRLQA-------------QYTHWVGRSDFIEHGSGDISLIR-TPHVDFWSLVNKVELPRYD 143
            ...|..|..             .||...|...    .||||:|:: :..|...|.|..|.||...
Mouse   139 QVHLGELTVTLSPHFSTVKRIIMYTGSPGPPG----SSGDIALVQLSSPVALSSQVQPVCLPEAS 199

  Fly   144 -DRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVD--VQIGENSVCENYYGSFSG-----DLICIP 200
             |.|...|.|   |:|||.|.:...:....|..:  |.:.:...|...|.|.:|     |::|..
Mouse   200 ADFYPGMQCW---VTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCAR 261

  Fly   201 TPENKGTCSGDSGGPLVIHDGN--RQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
            .|.:  .|..|||||||.....  :|.|:||:|...| ..:.|....|||:|::||
Mouse   262 GPGD--ACQDDSGGPLVCQVAGTWQQAGVVSWGEGCG-RPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 74/249 (30%)
Tryp_SPc 41..257 CDD:238113 76/251 (30%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.