DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and TPSG1

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:252 Identity:77/252 - (30%)
Similarity:109/252 - (43%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DVPVGKASIE---GRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGME 87
            |:..|:..:.   |||..|:.|..|..|:...|...:   ...||||::...||:||.||..|..
Human    48 DLGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRR---VHVCGGSLLSPQWVLTAAHCFSGSL 109

  Fly    88 SVTIYYGALWRLQAQYT-HWVGRSDFIEHG--------SGDISLIR-TPHVDFWSLVNKVELPRY 142
            :.:.|...|..|:...: |:......|.|.        ||||:|:. :..|...|.:..|.||..
Human   110 NSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPEA 174

  Fly   143 DDRYNNYQGWWALVSGWGKTSD-EGGVSEY-LNCVDVQIGENSVCENYYGSFSG-----DLICIP 200
            .|.:......|  |:|||.|.: |.....| |..|.|.:.:...|...|....|     |::|..
Human   175 SDDFCPGIRCW--VTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR 237

  Fly   201 TPENKGTCSGDSGGPLV--IHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            .|.:  .|..|||||||  ::....|.|.||:|...| ..|.|....||.:|::|||
Human   238 GPGD--ACQDDSGGPLVCQVNGAWVQAGTVSWGEGCG-RPNRPGVYTRVPAYVNWIR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 71/235 (30%)
Tryp_SPc 41..257 CDD:238113 72/234 (31%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 71/235 (30%)
Tryp_SPc 63..293 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.