DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30323

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:209 Identity:35/209 - (16%)
Similarity:68/209 - (32%) Gaps:72/209 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GGGTWCGGSIIGNTWVMTAKHCT-----------DGMESVTIYYGALWRLQ------AQYTHWVG 108
            |...:|.||::...||:|:..|.           ...:::.:......||:      ..:...:.
  Fly    49 GDNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIV 113

  Fly   109 RSDFIEHGSGDISLIRTPHVD-------FWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEG 166
            ..:....|..:::|::   :|       |..::.:.||         ...|.....|||:.    
  Fly   114 LDESAISGCTELALLK---LDRGVTGQRFAMMLPEKEL---------NSTWLCNSLGWGRI---- 162

  Fly   167 GVSEYLNCVDV--------QIGENSVCENYYGSFSGDLI--------------------CIPTPE 203
               .|::.|.:        .:.:|.|.....|.:|.:||                    |:.:..
  Fly   163 ---YYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYT 224

  Fly   204 NKGT-CSGDSGGPL 216
            .:|. |..|.|.||
  Fly   225 GRGNMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 35/209 (17%)
Tryp_SPc 41..257 CDD:238113 35/209 (17%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 35/209 (17%)
Tryp_SPc 45..272 CDD:214473 35/209 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.