DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30286

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:243 Identity:65/243 - (26%)
Similarity:109/243 - (44%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYG---ALWRLQAQY 103
            :.|:..:.|:   :.:....|...|||:::.:.:::||.||....|::|:..|   :|..:....
  Fly    39 HQAHISESPW---MAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNG 100

  Fly   104 THWVGRSDFIE------HGS-------GDISLIRTP-------HVDFWSLVNKVELPRYDDRYNN 148
            :..:..|:..|      ||.       .||.|:|..       |:....|:....|....:|.:.
  Fly   101 SDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHR 165

  Fly   149 YQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVC-ENYYGSFSGDLICIPTPENKGTCSGDS 212
                 .:.:|||::..| ..:..|..:.|......|| :.|:.....|.||: :.|:..:|||||
  Fly   166 -----LVATGWGRSPSE-AANHILKSIRVTRVNWGVCSKTYWVDRRRDQICV-SHESGVSCSGDS 223

  Fly   213 GGPL---VIHDGN---RQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
            |||:   :..||.   .||||||:| :|.|||  |.....|..::|||
  Fly   224 GGPMGQAIRLDGRVLFVQVGIVSYG-NAECLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 63/241 (26%)
Tryp_SPc 41..257 CDD:238113 65/243 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 65/243 (27%)
Tryp_SPc 39..268 CDD:214473 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.