DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30187

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:115/289 - (39%) Gaps:93/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VFW--KDV-------PVGKASIEGRITMGY-PAYEGKVPYIVGLGFSKNGGGTW----------- 65
            :||  |||       .:...:|..:||.|: .|::..|               |           
  Fly    11 IFWFLKDVGASIFLDQICGINIALKITGGHNAAFQNSV---------------WMAAVHNRTHFI 60

  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIE---HGS--------GD 119
            |||::|...:|:||.||....:..::..||..:...     ..|.|.|.   |.|        .|
  Fly    61 CGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDP-----ADRKDVITAVVHSSFDVRASYEND 120

  Fly   120 ISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVS-GWG-----KTSD--EGGVSEYLN-- 173
            |.|:: :..|.|.:|:..:.:.......|:.:......: |||     ||||  :..:..:|:  
  Fly   121 IGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDRE 185

  Fly   174 -C---VDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHD------GNRQV--G 226
             |   :.|...|..:|.   |..|||           ||.|||||||. :|      |||:|  |
  Fly   186 ECYMELSVYPSEKQICA---GVPSGD-----------TCGGDSGGPLT-NDVFIQGIGNREVQFG 235

  Fly   227 IVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            |:|.|.:: |  :|......:.|:.|||:
  Fly   236 IISVGKTS-C--DGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 67/262 (26%)
Tryp_SPc 41..257 CDD:238113 67/261 (26%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 67/262 (26%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.