DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30098

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:221 Identity:50/221 - (22%)
Similarity:91/221 - (41%) Gaps:57/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGAL------------WRLQAQYTHWVGRSDFIEHGSG 118
            ||||:|...:|:||.|||...:::.:..|..            :|:.:.|.|    .::|:..:.
  Fly    60 CGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRH----KNYIDFRNH 120

  Fly   119 DISLIRTP----------------HVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGG 167
            ||::::..                :....||.|.::         |:     .::|||:.:....
  Fly   121 DIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ---------NF-----TLTGWGQMAHYYK 171

  Fly   168 VSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPL--VIHDGNRQVGIVSF 230
            :...|..:.::...|..|.  ..|.|   ||...|. :..|.|||||||  ::..|::.: .|.|
  Fly   172 MPTTLQEMSLRRVRNEYCG--VPSLS---ICCWNPV-QYACFGDSGGPLGSLVKYGHKTI-YVQF 229

  Fly   231 GSSAGCLSN--GPKGMVRVTSYLDWI 254
            |.:.....|  |....:.:.||:.|:
  Fly   230 GVTNSVTGNCDGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 49/219 (22%)
Tryp_SPc 41..257 CDD:238113 50/221 (23%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 49/218 (22%)
Tryp_SPc 37..258 CDD:238113 50/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.