DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30091

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:304 Identity:77/304 - (25%)
Similarity:115/304 - (37%) Gaps:102/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGAL----- 96
            :|..|..|.|.|.|:   :...|......||||:|.|.:|:||.||....|...:.|..|     
  Fly    36 KIVGGVDAGELKNPW---MALIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLG 97

  Fly    97 -WRLQAQYTH------------WVGRSDFIEHGSGDISLIRTPHVDFWSLVNKVEL--------- 139
             :.|.|...|            ::..|..|::...||:|:|...    |:|.|.::         
  Fly    98 VYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQK----SIVYKPQIKPLCILLND 158

  Fly   140 ---PRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCE-NYYGSFSGDLICIP 200
               |:.|    ..|.:.|:  |||.|.: |.:|..|..|.:...:..:|| .::.:|...:.|..
  Fly   159 QLKPQTD----LIQEFTAI--GWGVTGN-GKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAG 216

  Fly   201 TPENKGTCSGDSGGPLVIH---DGNR---QVGIVSFGS--------------------------- 232
            |...:.||..||||||.||   ||.:   |:||||.|:                           
  Fly   217 TAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIERIVLDAD 281

  Fly   233 -----------SAGCLSN---------GPKGMVRVTSYLDWIRD 256
                       .||||.|         ||..   :.|: :|:.:
  Fly   282 IEVVLPYIDLLDAGCLGNDTLNSWDRSGPDA---IRSF-EWLAE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 76/300 (25%)
Tryp_SPc 41..257 CDD:238113 76/300 (25%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 68/250 (27%)
Tryp_SPc 37..276 CDD:238113 68/252 (27%)
Trypsin 310..520 CDD:278516 3/16 (19%)
Tryp_SPc 313..520 CDD:304450 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.