DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG30087

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:111/258 - (43%) Gaps:66/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRL-- 99
            |:..|..|.....|::|   :..|...|.|||||:.:.:::||.||        ::.....||  
  Fly    41 RVVNGKEAVIRSAPFMV---YVTNNSLTHCGGSILNSRYILTAAHC--------VFPNLRLRLGE 94

  Fly   100 -------QAQYTHWVGRSDFIEHG---------------SGDISLIR-------TPHVD-FWSLV 134
                   ..|.::...||:  |:|               ..||:|::       ..|:. ...|:
  Fly    95 HNIRTDPDCQGSNCSPRSE--EYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILL 157

  Fly   135 NKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVC-ENYYGSFSGDLIC 198
            |....|    ....||.:     |||:|. :.|....|...:::..:.:.| .:::...:|:.||
  Fly   158 NPASAP----SVATYQTF-----GWGETK-KNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQIC 212

  Fly   199 IPTPENKGTCSGDSGGPLVIH---DGNR---QVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
             ...|.:.||:||||||||..   ||.:   |:||||:|.: .|.|  |.....|.:|::|||
  Fly   213 -AGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPT-DCQS--PGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 66/255 (26%)
Tryp_SPc 41..257 CDD:238113 68/254 (27%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 66/255 (26%)
Tryp_SPc 42..272 CDD:238113 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.