DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Klk1b3

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:261 Identity:66/261 - (25%)
Similarity:105/261 - (40%) Gaps:64/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHC-TDGMESVTIYYGALW 97
            ::.|:..||.......|:.|.:.:.   |...|||.:|..:||:||.|| ||             
  Rat    25 VQSRVVGGYNCEMNSQPWQVAVYYF---GEYLCGGVLIDPSWVITAAHCATD------------- 73

  Fly    98 RLQAQYTHWVGRSD------FIEHG---------------------------SGDISLIR-TPHV 128
                .|..|:||::      |.:|.                           |.|:.|:. :...
  Rat    74 ----NYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPA 134

  Fly   129 DFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEG-GVSEYLNCVDVQIGENSVCENYYGSF 192
            |....|..::||..:.:.    |...|.||||..:.:| .:|:.|.||::.:..|..|...:...
  Rat   135 DITDGVKVIDLPIEEPKV----GSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAHKEE 195

  Fly   193 SGDL-ICIPTPE-NKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255
            ..|| :|....: .|.||.|||||||:. :|..| ||.|:|.:.......|....::..:..||:
  Rat   196 VTDLMLCAGEMDGGKDTCKGDSGGPLIC-NGVLQ-GITSWGFNPCGEPKKPGIYTKLIKFTPWIK 258

  Fly   256 D 256
            :
  Rat   259 E 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 64/254 (25%)
Tryp_SPc 41..257 CDD:238113 65/254 (26%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 64/254 (25%)
Tryp_SPc 29..260 CDD:238113 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.