DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and try-10

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:258 Identity:49/258 - (18%)
Similarity:80/258 - (31%) Gaps:104/258 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GFSKN----------------GGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYT 104
            |||.|                |....|||.:|..:.|:|:.||        ::.|..:.:.|:.|
 Worm    78 GFSANSFDTLSLASVITRFPDGTTNVCGGVLIAPSIVITSAHC--------VFSGDDFAVTAKVT 134

  Fly   105 --------HWVGRSDFIEH--------------GSGDISLIRTPH-------------------- 127
                    |..|..:|..|              .:.|:::|..|.                    
 Worm   135 LGDVHLNKHDDGEQEFRSHAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTG 199

  Fly   128 -VDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVD---VQIGENSVCENY 188
             |:|.......:|        ..:.....|:|||||  |...::|.:.|.   |.:....:.:..
 Worm   200 SVNFKETAPLTQL--------QLETSVCYVAGWGKT--ENKTAKYSDSVRQMMVNLSVRRIGKRK 254

  Fly   189 YGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYL 251
            |      ||......:...|.||||.|:.                  |..||.:.:|...:::
 Worm   255 Y------LIAKAVTGSSRACMGDSGSPVY------------------CFVNGKRILVGTVAHI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 49/258 (19%)
Tryp_SPc 41..257 CDD:238113 49/258 (19%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 49/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.