Sequence 1: | NP_001286951.1 | Gene: | Jon65Ai / 38685 | FlyBaseID: | FBgn0035667 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256475.1 | Gene: | try-10 / 179787 | WormBaseID: | WBGene00008849 | Length: | 355 | Species: | Caenorhabditis elegans |
Alignment Length: | 258 | Identity: | 49/258 - (18%) |
---|---|---|---|
Similarity: | 80/258 - (31%) | Gaps: | 104/258 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 GFSKN----------------GGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYT 104
Fly 105 --------HWVGRSDFIEH--------------GSGDISLIRTPH-------------------- 127
Fly 128 -VDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVD---VQIGENSVCENY 188
Fly 189 YGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYL 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon65Ai | NP_001286951.1 | Tryp_SPc | 37..254 | CDD:214473 | 49/258 (19%) |
Tryp_SPc | 41..257 | CDD:238113 | 49/258 (19%) | ||
try-10 | NP_001256475.1 | Tryp_SPc | 75..290 | CDD:389826 | 49/253 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1522379at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.110 |