DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:289 Identity:91/289 - (31%)
Similarity:132/289 - (45%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLL--LGVIASATAFEKPVFWKDVPVG-KASIEGRITMGYPAYEGKVPYIVGLGFSKNGG 62
            :|.|.:||  |.::||.      |:....|.. :..|.|    |:.|.|.|.|:.|.|.|..|..
Mouse     2 LKRLLLLLWALSLLASL------VYSAPRPANQRVGIVG----GHEASESKWPWQVSLRFKLNYW 56

  Fly    63 GTWCGGSIIGNTWVMTAKHCTD-----------GMESVTIYYG----ALWRLQAQYTHWVGRSDF 112
            ..:||||:|...||:||.||..           .:....:|||    :|.|: ..:.|:     :
Mouse    57 IHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRI-VVHPHY-----Y 115

  Fly   113 IEHGSGDISL--IRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGK-TSDEGGVSEY-LN 173
            ...|..|::|  :..| |:..:.::.:.||...:.:......|  |:|||. .:||.....| |.
Mouse   116 TAEGGADVALLELEVP-VNVSTHLHPISLPPASETFPPGTSCW--VTGWGDIDNDEPLPPPYPLK 177

  Fly   174 CVDVQIGENSVCENYY--GSFSGD--------LICIPTPENKGTCSGDSGGPLV--IHDGNRQVG 226
            .|.|.|.|||:|:..|  |.::||        ::|... ..:.:|.||||||||  :.....|.|
Mouse   178 QVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGN-TRRDSCQGDSGGPLVCKVKGTWLQAG 241

  Fly   227 IVSFGSSAGCLS-NGPKGMVRVTSYLDWI 254
            :||:|.  ||.. |.|....|||.|||||
Mouse   242 VVSWGE--GCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 78/248 (31%)
Tryp_SPc 41..257 CDD:238113 80/246 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.