DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CTRL

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:280 Identity:79/280 - (28%)
Similarity:121/280 - (43%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LAVLLLG--------VIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKN 60
            |:::|||        .|..|.:|.:                ||..|..|..|..|:.|.|  ..:
Human     8 LSLVLLGSSWGCGIPAIKPALSFSQ----------------RIVNGENAVLGSWPWQVSL--QDS 54

  Fly    61 GGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWR-LQAQYTHWVGRSDFIEHGS------- 117
            .|..:||||:|..:||:||.||........:..|...| ..|:....:..|..|.|.|       
Human    55 SGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMN 119

  Fly   118 GDISLIR--TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVS-EYLNCVDVQI 179
            .|::|::  :| ..:.:.::.|.|...::...  :|...:.:|||:.|..|.|: .:|..|.:.:
Human   120 NDVTLLKLASP-AQYTTRISPVCLASSNEALT--EGLTCVTTGWGRLSGVGNVTPAHLQQVALPL 181

  Fly   180 GENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQV--GIVSFGSSAGCLSNGPK 242
            ...:.|..|:||...|.:.........:|.||||||||...||..|  ||||:|:. .|....|.
Human   182 VTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTK-NCNVRAPA 245

  Fly   243 GMVRVTSYLDWIRDNTGISY 262
            ...||:.:..||  |..|:|
Human   246 VYTRVSKFSTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 67/229 (29%)
Tryp_SPc 41..257 CDD:238113 67/228 (29%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.