DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG43742

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:285 Identity:81/285 - (28%)
Similarity:132/285 - (46%) Gaps:72/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGS 69
            ::||:.|:....||.:.:   |... |..|..|:..|:.|...:  ::..|   .|....:||||
  Fly     6 SLLLVAVVIYQNAFAQLL---DENC-KVKITYRVANGHTAITSQ--FMAAL---YNNSEFFCGGS 61

  Fly    70 IIGNTWVMTAKHCTDGMESVTIYYGA------------LWRLQAQYTHWVGRSDFIEHGS---GD 119
            :|...:|:||.||...::.||::.|.            :.||.|:.   :...:|  ||:   .|
  Fly    62 LIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKV---ILHPNF--HGNIFLND 121

  Fly   120 ISLIRTP-HVDFWSLVNKVELPRYDD----RYNNYQGWWALVSGWGKTSDEGGVSEYLNCVD-VQ 178
            |:|:|.. .|.|.:.:..:.:...:|    ..||:..:     ||||| :.|.:|:.|:.:| |:
  Fly   122 IALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAY-----GWGKT-EHGNISDVLSFIDLVR 180

  Fly   179 IGE-------NSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLV---IHDG-NRQV--GIVSF 230
            :.:       |::|.   ||.|||           ||..||||||:   :|.| :|.:  ||.|:
  Fly   181 LPKSMCYQNINTICA---GSTSGD-----------TCESDSGGPLIGNFVHRGKSRDILFGITSY 231

  Fly   231 GSSAGCLSNGPKGM-VRVTSYLDWI 254
            | .|.|  :|..|: ..|.:|..||
  Fly   232 G-DAEC--SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 71/251 (28%)
Tryp_SPc 41..257 CDD:238113 72/249 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 71/251 (28%)
Tryp_SPc 35..256 CDD:238113 72/252 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.