DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG43335

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:215 Identity:59/215 - (27%)
Similarity:92/215 - (42%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WCGGSIIGNTWVMTAKHCTDGMESVTIYYG--ALWRLQAQYTHWVGRSDF-----IEHG------ 116
            :|.|::|.|.:|:||.||.:..:::|:..|  .|.|....... :...|:     |:|.      
  Fly    66 FCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQ-ITAEDYSVSMAIKHKYFTPSI 129

  Fly   117 -SGDISLIRTPH-VDFWSLVNKVEL---PRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVD 176
             ..||::||... |.|:..:..:.:   |..  |.....|...:.:||| .:|:......|....
  Fly   130 MLNDIAMIRLARTVKFYDHIRPICIILDPAV--RLLLEDGMTLMATGWG-LADKRMHPHLLQEAP 191

  Fly   177 VQIGENSVCENYYG-SFSGDLICIPTPENKGTCSGDSGGPL---VIHDGNR---QVGIVSFGSSA 234
            :.:...:||...|. :.:...||....|. .||.|||||||   |.:.|:.   |.||.||| ..
  Fly   192 ITVMNRNVCSKLYDVAITQGQICAGDKET-NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFG-DI 254

  Fly   235 GCLSNGPKGMVRVTSYLDWI 254
            .|.|  |.....:::|..||
  Fly   255 ECRS--PSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 57/213 (27%)
Tryp_SPc 41..257 CDD:238113 59/215 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 57/213 (27%)
Tryp_SPc 42..275 CDD:238113 59/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.