DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG43124

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:218 Identity:41/218 - (18%)
Similarity:77/218 - (35%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGA--------LWRLQAQYTHWVGRSDFIEHGSGDISL 122
            |.|::|.|.:|:||..|....|.:|:..|:        .:|:...| .|:  :.|..:.:.::.:
  Fly    54 CAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVTKAY-FWM--THFPANNTNNLCI 115

  Fly   123 IR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCE 186
            .| ...|:|.:.:..:.:.                    |:....|::.....::.:......|:
  Fly   116 FRLQTEVEFKTHIRPMCIT--------------------KSPKSLGLATTFEIINEKPKMWYFCK 160

  Fly   187 NYYGSFSGDLICIPTPENKGTC-SGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGP-KGMVR--- 246
            |..|.|...:.    .||:... |..:|.|.                 ...:|||| ||:||   
  Fly   161 NIKGLFCKYVF----GENEEKWQSKPTGSPW-----------------TETISNGPFKGLVRYGI 204

  Fly   247 ---------------VTSYLDWI 254
                           |.|:::||
  Fly   205 LSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 39/216 (18%)
Tryp_SPc 41..257 CDD:238113 41/218 (19%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.