DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG43125

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:296 Identity:60/296 - (20%)
Similarity:99/296 - (33%) Gaps:105/296 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGS 69
            |.|.|.|.|....::....:.:...||:|:..      ||     |::|.:....:...| |.|:
  Fly     3 ATLRLAVFALLLFYQGSALFLEQNCGKSSVFS------PA-----PWLVKIRPELSSNIT-CTGT 55

  Fly    70 IIGNTWVMTAKHCTDGMESVTIYYGAL-------WRLQAQYTH----WVGRSDFIEHGSGDISLI 123
            :|...:|:||..|.|....:.:..|.:       .:||.:..:    .:.||...|....:|:|:
  Fly    56 LINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALL 120

  Fly   124 RTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIG-------- 180
            |..    .|:|.|..:...                               |:||.:|        
  Fly   121 RLK----TSVVYKKNIQPI-------------------------------CIDVNVGKVPKAPTF 150

  Fly   181 --ENSVCE--------------NYYGSFSG------DLICIPTPENKGTCSGDSGGPLV--IHDG 221
              |....|              |::.|..|      |:|..|.|.       ..|.||.  |::.
  Fly   151 EIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPI-------AVGWPLTKQINES 208

  Fly   222 N--RQVGIVSFGSSAGCLSNGPKGM-VRVTSYLDWI 254
            .  .|.||:|..:     |...|.: ..|.:|::||
  Fly   209 ALFHQYGILSHRN-----SESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 50/262 (19%)
Tryp_SPc 41..257 CDD:238113 52/260 (20%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 23/135 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.