DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Ctrl

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:251 Identity:80/251 - (31%)
Similarity:107/251 - (42%) Gaps:37/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHC--TDGMESVTIYYGA 95
            |...||..|..|..|..|:.|.|  ..|.|..:||||:|...||:||.||  |.|...|.:  |.
  Rat    29 SYNQRIVNGENAVPGSWPWQVSL--QDNTGFHFCGGSLIAPNWVVTAAHCKVTPGRHFVIL--GE 89

  Fly    96 LWR-LQAQYTHWVGRSDFIEHGS-------GDISLIR-------TPHVDFWSLVNKVE-LPRYDD 144
            ..| ..|:....:..|..|.|.|       .|::|::       |..|....|.:..| ||    
  Rat    90 YDRSSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASPARYTAQVSPVCLASSNEALP---- 150

  Fly   145 RYNNYQGWWALVSGWGKTSDEGGVS-EYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTC 208
                 .|...:.:|||:.|..|.|: ..|..|.:.:...:.|..|:||...|.:.........:|
  Rat   151 -----AGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSRITDSMICAGGAGASSC 210

  Fly   209 SGDSGGPLVIHDGNRQV--GIVSFGSSAGCLSNGPKGMVRVTSYLDWIRDNTGISY 262
            .||||||||...||..|  ||||:|:. .|....|....||:.:..||  |..|:|
  Rat   211 QGDSGGPLVCQKGNTWVLIGIVSWGTE-NCNVQAPAMYTRVSKFNTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 74/237 (31%)
Tryp_SPc 41..257 CDD:238113 74/236 (31%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 74/237 (31%)
Tryp_SPc 34..260 CDD:238113 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.