DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Cela1

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:265 Identity:73/265 - (27%)
Similarity:111/265 - (41%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW---CGGSIIGNTWVMTAKHCTDGM 86
            :|||    ..:.|:..|..|.....|..:.|.:..  ||:|   |||::|.:.|||||.||.|..
Mouse    18 EDVP----ETDARVVGGAEARRNSWPSQISLQYQY--GGSWHHTCGGTLIRSNWVMTAAHCVDSP 76

  Fly    87 ESVTIYYGALWRLQAQYT-HWVGRSDFIEH---------GSGDISLIRTPHVDFWSLVNKVELPR 141
            .:..:..|.....|...| .:|.....:.|         ...||:|:|        |...|.|  
Mouse    77 MTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLR--------LAKSVTL-- 131

  Fly   142 YDDRYNNYQGWWAL--------------VSGWGKTSDEGGVSEYLNCVDVQIGENSVC--ENYYG 190
                 |||.....|              ::|||:|...|.:::.|....:.....|:|  .:|:|
Mouse   132 -----NNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVSYSICSSSSYWG 191

  Fly   191 -SFSGDLICIPTPENKGTCSGDSGGPL-VIHDGNRQV-GIVSFGSSAGC-LSNGPKGMVRVTSYL 251
             |....::|......:..|.||||||| .:.:|...| |:.||.||.|| ::..|....||::|:
Mouse   192 SSVKNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVHGVTSFVSSMGCNVARKPTVFTRVSAYI 256

  Fly   252 DWIRD 256
            .|:.:
Mouse   257 SWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 69/249 (28%)
Tryp_SPc 41..257 CDD:238113 69/249 (28%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 69/248 (28%)
Tryp_SPc 27..262 CDD:238113 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.