DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and PRSS21

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:299 Identity:80/299 - (26%)
Similarity:126/299 - (42%) Gaps:61/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPV----GKASIEGRITMGYPAYEGKVPYIVGLGFSKNG 61
            |.....|||.::.:.....||...:..|:    |:..|..||..|..|..|:.|:...|..    
Human     1 MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRL---- 61

  Fly    62 GGTW----CGGSIIGNTWVMTAKHCTDGMESVT------IYYGAL------WRLQAQYT------ 104
               |    ||.|::.:.|.:||.||.:....::      :.:|.|      |.|||.||      
Human    62 ---WDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSN 123

  Fly   105 -----HWVGRSDFIEHGSGDISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGK-T 162
                 .::|.|.:      ||:|:: :..|.:...:..:.|......:.|....|  |:|||. .
Human   124 IYLSPRYLGNSPY------DIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCW--VTGWGYIK 180

  Fly   163 SDEGGVSEY-LNCVDVQIGENSVCENYYGSFS------GDLICIPTPE-NKGTCSGDSGGPLVIH 219
            .||...|.: |..|.|.|..||:|.:.:..:|      ||::|....: .|..|.|||||||..:
Human   181 EDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACN 245

  Fly   220 DGN--RQVGIVSFGSSAGC-LSNGPKGMVRVTSYLDWIR 255
            ...  .|:|:||:|  .|| ..|.|.....::.:.:||:
Human   246 KNGLWYQIGVVSWG--VGCGRPNRPGVYTNISHHFEWIQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 69/256 (27%)
Tryp_SPc 41..257 CDD:238113 69/255 (27%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.